-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP1R3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PPP1R3B (NP_078883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPP1R3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PPP1R3B (NP_078883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05365A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP1R3B |
| Target Synonyms | GL; PTG; PPP1R4; PPP1R3B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PPP1R3B (NP_078883.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVL | Uniprot ID | Q86XI6 |
Uniprot Id
Q86XI6
Target Species
Human
Target Name
PPP1R3B
Target Full Name
Protein phosphatase 1 regulatory subunit 3B
Target Function
Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.
Target Tissue Specificity
Highly expressed in the liver and, at lower levels, in skeletal muscle, including in vastus lateralis, gastrocnemius and soleus (at protein level). Highest mRNA levels are observed in skeletal muscle, and only moderate levels in liver and heart. Weak expr
Target Synonyms
FLJ14005; FLJ34675; GL; Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL ; Hepatic glycogen targeting subunit G(L); Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL; PP1 subunit R4; Ppp1r3b; PPP1R4; PPR3B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 3B; Protein phosphatase 1 regulatory subunit 3B; Protein phosphatase 1 regulatory subunit 4; Protein phosphatase 1 subunit 4; Protein phosphatase 1 subunit GL; PTG; R4
Target Background
This gene encodes the catalytic subunit of the serine/theonine phosphatase, protein phosphatase-1. The encoded protein is expressed in liver and skeletal muscle tissue and may be involved in regulating glycogen synthesis in these tissues. This gene may be a involved in type 2 diabetes and maturity-onset diabetes of the young. Alternate splicing results in multiple transcript variants that encode the same protein.
Notification