-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 164-263 of human PSMA1 (P25786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PSMA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 164-263 of human PSMA1 (P25786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16032A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMA1 |
| Target Synonyms | NU; HC2; PROS30; HEL-S-275; PSMA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, MCF7, Mouse brain, Mouse liver, Mouse spleen, Rat liver, Rat spleen, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 164-263 of human PSMA1 (P25786). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH | Uniprot ID | P25786 |
Uniprot Id
P25786
Target Species
Human
Target Name
PSMA1
Target Full Name
Proteasome subunit alpha type-1
Target Function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase T1A family
Target Research Area
Immunology
Target Synonyms
30 kDa prosomal protein; HC 2; HC2; Macropain subunit C2; Macropain subunit nu; MGC14542; MGC14575; MGC14751; MGC1667; MGC21459; MGC22853; MGC23915; Multicatalytic endopeptidase complex subunit C2; NU; PROS 30; PROS-30; PROS30; Proteasome (prosome macropain) subunit alpha type 1; Proteasome alpha 1 subunit; Proteasome component C2; Proteasome nu chain; Proteasome subunit alpha type 1; Proteasome subunit alpha type I; Proteasome subunit alpha type-1; Proteasome subunit nu; Protein P30 33K; PSA1_HUMAN; PSC 2; PSC2; PSMA 1; psmA1
Target Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification