-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPRB was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1173-1260 of human PTPRB (NP_002828.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTPRB was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1173-1260 of human PTPRB (NP_002828.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02771A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPRB |
| Target Synonyms | PTPB; HPTPB; VEPTP; HPTP-BETA; R-PTP-BETA; PTPRB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251 MG | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1173-1260 of human PTPRB (NP_002828.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PASVSHLRGSNRNTTDSLWFNWSPASGDFDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA | Uniprot ID | P23467 |
Uniprot Id
P23467
Target Species
Human
Target Name
PTPRB
Target Full Name
Receptor-type tyrosine-protein phosphatase beta
Target Function
Plays an important role in blood vessel remodeling and angiogenesis. Not necessary for the initial formation of blood vessels, but is essential for their maintenance and remodeling. Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin and KDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelial cells. Acts as a negative regulator of TIE2, and controls TIE2 driven endothelial cell proliferation, which in turn affects blood vessel remodeling during embryonic development and determines blood vessel size during perinatal growth. Essential for the maintenance of endothelial cell contact integrity and for the adhesive function of VE-cadherin in endothelial cells and this requires the presence of plakoglobin.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Protein-tyrosine phosphatase family, Receptor class 3 subfamily
Target Research Area
Signal Transduction
Target Synonyms
HPTP BETA; HPTPB; Phosphacan receptor type B; Protein tyrosine phosphatase receptor type B; Protein-tyrosine phosphatase beta; PTPB; Ptprb; PTPRB_HUMAN; R PTP BETA; R-PTP-beta; Receptor-type tyrosine-protein phosphatase beta; RPTPB; Vascular endothelial protein tyrosine phosphatase; VE-PTP
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and one intracytoplasmic catalytic domain, thus belongs to receptor type PTP. The extracellular region of this PTP is composed of multiple fibronectin type_III repeats, which was shown to interact with neuronal receptor and cell adhesion molecules, such as contactin and tenascin C. This protein was also found to interact with sodium channels, and thus may regulate sodium channels by altering tyrosine phosphorylation status. The functions of the interaction partners of this protein implicate the roles of this PTP in cell adhesion, neurite growth, and neuronal differentiation. Alternate transcript variants encoding different isoforms have been found for this gene.
Notification