-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human RAMP2 (NP_005845.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RAMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human RAMP2 (NP_005845.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00491A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAMP2 |
| Target Synonyms | RAMP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BxPC-3, MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human RAMP2 (NP_005845.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDV | Uniprot ID | O60895 |
Uniprot Id
O60895
Target Species
Human
Target Name
RAMP2
Target Full Name
Receptor activity-modifying protein 2
Target Function
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
RAMP family
Target Tissue Specificity
Strongly expressed in lung, breast, immune system and fetal tissues.
Target Synonyms
RAMP2; Receptor activity-modifying protein 2; Calcitonin-receptor-like receptor activity-modifying protein 2; CRLR activity-modifying protein 2
Target Background
The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.
Notification