-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RASD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 135-263 of human RASD2 (NP_055125.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RASD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 135-263 of human RASD2 (NP_055125.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06717A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RASD2 |
| Target Synonyms | Rhes; TEM2; RASD2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 135-263 of human RASD2 (NP_055125.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKC | Uniprot ID | Q96D21 |
Uniprot Id
Q96D21
Target Species
Human
Target Name
RASD2
Target Full Name
GTP-binding protein Rhes
Target Function
GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination.
Target Subcellular Location
Cell membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, RasD family
Target Tissue Specificity
Pancreatic endocrine cells (islets of Langerhans).
Target Synonyms
GTP binding protein Rhes; GTP-binding protein Rhes; MGC:4834; OTTHUMP00000197925; Ras homolog enriched in striatum; RASD 2; RASD family member 2; RASD2; Rhes; RHES_HUMAN; TEM 2; TEM2; Tumor endothelial marker 2
Target Background
This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients.
Notification