Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RASGRP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RASGRP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10758A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RASGRP3 |
| Target Synonyms | GRP3; RASGRP3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A-549, BT-474, Mouse lung, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-689 of human RASGRP3 (NP_056191.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG | Uniprot ID | Q8IV61 |
Uniprot Id
Q8IV61
Target Species
Human
Target Name
RASGRP3
Target Full Name
Ras guanyl-releasing protein 3
Target Function
Guanine nucleotide exchange factor (GEF) for Ras and Rap1.
Target Protein Families
RASGRP family
Target Research Area
Signal Transduction
Target Synonyms
Calcium and DAG-regulated guanine nucleotide exchange factor III; Grp3; GRP3_HUMAN; Guanine nucleotide exchange factor for Rap1; Kiaa0846; RAS guanyl releasing protein 3 (calcium and DAG regulated); RAS guanyl releasing protein 3 calcium and DAG regualated guanine nucleotide exchange factor iii; Ras guanyl-releasing protein 3; RASGRP3
Target Background
The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
