Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBM12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human RBM12 (NP_001185767.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBM12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human RBM12 (NP_001185767.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05507A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBM12 |
| Target Synonyms | SWAN; SCZD19; HRIHFB2091; RBM12 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human RBM12 (NP_001185767.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG | Uniprot ID | Q9NTZ6 |
Uniprot Id
Q9NTZ6
Target Species
Human
Target Name
RBM12
Target Full Name
RNA-binding protein 12
Target Involvement
Schizophrenia 19 (SCZD19)
Target Subcellular Location
Nucleus.
Target Synonyms
HRIHFB2091; KIAA0765; RBM 12; RBM12; RBM12_HUMAN; RNA binding motif protein 12; RNA binding protein 12; RNA-binding motif protein 12; RNA-binding protein 12; SH3/WW domain anchor protein in the nucleus; SWAN
Target Background
This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in four transcript variants. All variants encode the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
