Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RCE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RCE1 (NP_005124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RCE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RCE1 (NP_005124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07283A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RCE1 |
| Target Synonyms | FACE2; RCE1A; RCE1B; RCE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RCE1 (NP_005124.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTC | Uniprot ID | Q9Y256 |
Uniprot Id
Q9Y256
Target Species
Human
Target Name
RCE1
Target Full Name
CAAX prenyl protease 2
Target Function
Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Peptidase U48 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Others
Target Synonyms
RCE1; FACE2; RCE1A; RCE1B; CAAX prenyl protease 2; Farnesylated proteins-converting enzyme 2; FACE-2; Prenyl protein-specific endoprotease 2; RCE1 homolog; hRCE1
Target Background
This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
