Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RECQL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RECQL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09423A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RECQL4 |
| Target Synonyms | RECQ4; RECQL4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA | Uniprot ID | O94761 |
Uniprot Id
O94761
Target Species
Human
Target Name
RECQL4
Target Full Name
ATP-dependent DNA helicase Q4
Target Function
DNA-dependent ATPase. May modulate chromosome segregation.
Target Involvement
Rothmund-Thomson syndrome (RTS); RAPADILINO syndrome (RAPADILINOS); Baller-Gerold syndrome (BGS)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Helicase family, RecQ subfamily
Target Tissue Specificity
Ubiquitously expressed, with highest levels in thymus and testis.
Target Synonyms
ATP dependent DNA helicase Q4; ATP-dependent DNA helicase Q4; DNA helicase; DNA helicase, RecQ like type 4; RECQ 4; RECQ L4; RecQ protein 4; RecQ protein like 4; RecQ protein-like 4; RecQ-like type 4; RecQ4; RECQ4_HUMAN; RECQL 4; RECQL4; RTS
Target Background
The protein encoded by this gene is a DNA helicase that belongs to the RecQ helicase family. DNA helicases unwind double-stranded DNA into single-stranded DNAs and may modulate chromosome segregation. This gene is predominantly expressed in thymus and testis. Mutations in this gene are associated with Rothmund-Thomson, RAPADILINO and Baller-Gerold syndromes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
