Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REEP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against REEP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06087A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REEP2 |
| Target Synonyms | SPG72; Yip2d; C5orf19; SGC32445; REEP2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse testis, Rat testis, RD | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 93-252 of human REEP2 (NP_057690.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA | Uniprot ID | Q9BRK0 |
Uniprot Id
Q9BRK0
Target Species
Human
Target Name
REEP2
Target Full Name
Receptor expression-enhancing protein 2
Target Function
Required for endoplasmic reticulum (ER) network formation, shaping and remodeling. May enhance the cell surface expression of odorant receptors.
Target Involvement
Spastic paraplegia 72 (SPG72)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
DP1 family
Target Tissue Specificity
Detected in brain, heart and skeletal muscle, and at low levels in placenta, kidney and pancreas. Expressed in circumvallate papillae.
Target Synonyms
REEP2; C5orf19; SGC32445; Receptor expression-enhancing protein 2
Target Background
This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
