Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHOU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human RHOU (NP_067028.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RHOU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human RHOU (NP_067028.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02306A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOU |
| Target Synonyms | ARHU; G28K; WRCH1; hG28K; CDC42L1; RHOU | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40-100 of human RHOU (NP_067028.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ | Uniprot ID | Q7L0Q8 |
Uniprot Id
Q7L0Q8
Target Species
Human
Target Name
RHOU
Target Full Name
Rho-related GTP-binding protein RhoU
Target Function
Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor. Cell junction, focal adhesion. Cell projection, podosome.
Target Protein Families
Small GTPase superfamily, Rho family
Target Tissue Specificity
Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta.
Target Synonyms
ARHU; CDC42 L1; CDC42 like GTPase; CDC42-like GTPase 1; CDC42L1; G28K; GTP binding protein like 1; GTP binding protein SB128; GTP-binding protein-like 1; hG28K; mG28K; Ras homolog gene family member U; Ras homolog gene family member U isoform CRA a; Ras like gene family member U; Rho GTPase like protein ARHU; Rho GTPase-like protein ARHU; Rho related GTP binding protein RhoU; Rho-related GTP-binding protein RhoU; Rhou; RHOU_HUMAN; Ryu GTPase; Wnt-1 responsive Cdc42 homolog 1; Wnt1 responsive Cdc42 homolog; WRCH 1; WRCH-1
Target Background
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
