Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates using RND1 Rabbit pAb at 1:3000 dilution.
| Cat.No | ADA-06100A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RND1 |
| Target Synonyms | ARHS; RHO6; RHOS; RND1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM | Uniprot ID | Q92730 |
Uniprot Id
Q92730
Target Species
Human
Target Name
RND1
Target Full Name
Rho-related GTP-binding protein Rho6
Target Function
Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton.
Target Protein Families
Small GTPase superfamily, Rho family
Target Tissue Specificity
Mostly expressed in brain and liver.
Target Synonyms
ARHS; FLJ42294; GTP binding protein RHO6; Ras homolog gene family member S; RHO 6; Rho family GTPase 1; Rho related GTP binding protein Rho6; RHO S; Rho-related GTP-binding protein Rho6; RHO6; RHOS; RND 1; Rnd1; RND1_HUMAN
Target Background
This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
