-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF144B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RNF144B (NP_877434.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF144B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RNF144B (NP_877434.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06086A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF144B |
| Target Synonyms | PIR2; IBRDC2; p53RFP; bA528A10.3; RNF144B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RNF144B (NP_877434.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYI | Uniprot ID | Q7Z419 |
Uniprot Id
Q7Z419
Target Species
Human
Target Name
RNF144B
Target Full Name
E3 ubiquitin-protein ligase RNF144B
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se.
Target Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Note=Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation.
Target Protein Families
RBR family, RNF144 subfamily
Target Tissue Specificity
Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis.
Target Synonyms
RNF144B; IBRDC2; P53RFP; E3 ubiquitin-protein ligase RNF144B; IBR domain-containing protein 2; RING finger protein 144B; p53-inducible RING finger protein
Target Background
Enables ubiquitin-protein transferase activity. Involved in negative regulation of apoptotic process and ubiquitin-dependent protein catabolic process. Located in mitochondrial membrane.
Notification