-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL35A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPL35A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07162A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL35A |
| Target Synonyms | DBA5; L35A; eL33; RPL35A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRS | Uniprot ID | P18077 |
Uniprot Id
P18077
Target Species
Human
Target Name
RPL35A
Target Full Name
Large ribosomal subunit protein eL33
Target Function
Required for the proliferation and viability of hematopoietic cells. Plays a role in 60S ribosomal subunit formation. The protein was found to bind to both initiator and elongator tRNAs and consequently was assigned to the P site or P and A site.
Target Involvement
Diamond-Blackfan anemia 5 (DBA5)
Target Protein Families
Eukaryotic ribosomal protein eL33 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
60S ribosomal protein L35a; Cell growth-inhibiting gene 33 protein; DBA5; L35A; Ribosomal Protein L35a; RL35A_HUMAN; RPL35A
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L35AE family of ribosomal proteins. It is located in the cytoplasm. The rat protein has been shown to bind to both initiator and elongator tRNAs, and thus, it is located at the P site, or P and A sites, of the ribosome. Although this gene was originally mapped to chromosome 18, it has been established that it is located at 3q29-qter. Alternative splicing results in multiple transcript variants. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification