-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS6KA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RPS6KA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10447A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS6KA2 |
| Target Synonyms | RSK; HU-2; RSK3; p90RSK2; p90-RSK3; pp90RSK3; MAPKAPK1C; S6K-alpha; S6K-alpha2; RPS6KA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, A-549, Mouse brian, PC-12, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL | Uniprot ID | Q15349 |
Uniprot Id
Q15349
Target Species
Human
Target Name
RPS6KA2
Target Full Name
Ribosomal protein S6 kinase alpha-2
Target Function
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Tissue Specificity
Widely expressed with higher expression in lung, skeletal muscle, brain, uterus, ovary, thyroid and prostate.
Target Synonyms
90 kDa ribosomal protein S6 kinase 2; HU 2; KS6A2_HUMAN; MAP kinase activated protein kinase 1c ; MAP kinase-activated protein kinase 1c; MAPK-activated protein kinase 1c; MAPKAP kinase 1c; MAPKAPK-1c; MAPKAPK1C; Mitogen.activated protein kinase-activated protein kinase 1C; p90 RSK3; p90-RSK 2; p90RSK2; pp90RSK3; Ribosomal protein S6 kinase alpha-2; ribosomal protein S6 kinase; 90kDa; polypeptide 2; Ribosomal S6 kinase 3; RPS6KA2; RSK 3; RSK; RSK-3; S6K alpha ; S6K alpha 2; S6K-alpha-2
Target Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternative splice variants, encoding different isoforms, have been characterized.
Notification