-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RSPO3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RSPO3 (NP_116173.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RSPO3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RSPO3 (NP_116173.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10917A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RSPO3 |
| Target Synonyms | PWTSR; THSD2; CRISTIN1; RSPO3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, Mouse brain, Mouse liver, Mouse skin, Mouse spinal cord, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RSPO3 (NP_116173.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKA | Uniprot ID | Q9BXY4 |
Uniprot Id
Q9BXY4
Target Species
Human
Target Name
RSPO3
Target Full Name
R-spondin-3
Target Function
Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Acts as a key regulator of angiogenesis by controlling vascular stability and pruning: acts by activating the non-canonical Wnt signaling pathway in endothelial cells. Can also amplify Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3.
Target Subcellular Location
Secreted.
Target Protein Families
R-spondin family
Target Tissue Specificity
Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node. Highly expressed in endothelial cells.
Target Synonyms
CRISTIN1; hPWTSR; hRspo3; Protein with TSP type-1 repeat; PWTSR; R-spondin 3 homolog; R-spondin-3 [Precursor]; R-spondin-3; Roof plate specific spondin-3; Roof plate-specific spondin-3; RSPO3; RSPO3_HUMAN; Thrombospondin type I domain containing 2; Thrombospondin type-1 domain-containing protein 2; THSD2
Target Background
This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Notification