Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SDF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SDF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05051A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SDF4 |
| Target Synonyms | Cab45; SDF-4; SDF4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, Mosue liver, Mouse brain, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPANHSSTRERVANREENEILPPDHLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENL | Uniprot ID | Q9BRK5 |
Uniprot Id
Q9BRK5
Target Species
Human
Target Name
SDF4
Target Full Name
45 kDa calcium-binding protein
Target Function
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.; Isoform 5 may be involved in the exocytosis of zymogens by pancreatic acini.
Target Subcellular Location
[Isoform 1]: Golgi apparatus lumen.; [Isoform 5]: Cytoplasm. Cell membrane. Cell projection, bleb.
Target Protein Families
CREC family
Target Tissue Specificity
Ubiquitous. Isoform 5 is expressed in pancreas.
Target Research Area
Cancer
Target Synonyms
45 kDa calcium-binding protein; Cab45; CAB45_HUMAN; Calcium binding protein; PSEC0034; SDF 4; SDF-4; SDF4; Stromal cell derived factor 4; Stromal cell-derived factor 4
Target Background
This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium dependent cellular activities.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
