-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC62 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 214-314 of human SEC62 (NP_003253.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SEC62 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 214-314 of human SEC62 (NP_003253.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15444A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC62 |
| Target Synonyms | HTP1; TP-1; Dtrp1; TLOC1; SEC62 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Hep G2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 214-314 of human SEC62 (NP_003253.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSD | Uniprot ID | Q99442 |
Uniprot Id
Q99442
Target Species
Human
Target Name
SEC62
Target Full Name
Translocation protein SEC62
Target Function
Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
SEC62 family
Target Synonyms
SEC62; TLOC1; Translocation protein SEC62; Translocation protein 1; TP-1; hTP-1
Target Background
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER.
Notification