Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEMG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 312-462 of human SEMG1 (NP_002998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEMG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 312-462 of human SEMG1 (NP_002998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with SEMG1, using SEMG1 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
| Cat.No | ADA-08253A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEMG1 |
| Target Synonyms | SEMG1; CT103; SEMG; SGI; dJ172H20.2; semenogelin-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T-SEMG1-His(C) | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 312-462 of human SEMG1 (NP_002998.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT | Uniprot ID | P04279 |
Uniprot Id
P04279
Target Species
Human
Target Name
SEMG1
Target Full Name
Semenogelin-1
Target Function
Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.; Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
Target Subcellular Location
Secreted.
Target Protein Families
Semenogelin family
Target Tissue Specificity
Seminal vesicle.
Target Research Area
Cell Biology
Target Synonyms
Alpha-Inhibin-31; Alpha-Inhibin-92; Cancer/testis antigen 103; CT103; dJ172H20.2 (semenogelin I); dJ172H20.2; MGC14719; Semen coagulating protein; Semenogelin; Semenogelin I; SEMG; SEMG1; SEMG1_HUMAN; Seminal basic protein; seminal vesicle secretory protein 5; SgI; Svp-1; Svp5; SVPIIA; Svs2; SVS2P; Svs2p2; Svs5
Target Background
The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. This preproprotein is proteolytically processed by the prostate-specific antigen (PSA) protease to generate multiple peptide products that exhibit distinct functions. One of these peptides, SgI-29, is an antimicrobial peptide with antibacterial activity. This proteolysis process also breaks down the gel matrix and allows the spermatozoa to move more freely. This gene and another similar semenogelin gene are present in a gene cluster on chromosome 20.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
