-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPING1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERPING1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14365A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPING1 |
| Target Synonyms | C1IN; C1NH; HAE1; HAE2; C1INH; SERPING1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse plasma, Rat plasma | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SERPING1 (P05155). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV | Uniprot ID | P05155 |
Uniprot Id
P05155
Target Species
Human
Target Name
SERPING1
Target Full Name
Plasma protease C1 inhibitor
Target Function
Activation of the C1 complex is under control of the C1-inhibitor. It forms a proteolytically inactive stoichiometric complex with the C1r or C1s proteases. May play a potentially crucial role in regulating important physiological pathways including complement activation, blood coagulation, fibrinolysis and the generation of kinins. Very efficient inhibitor of FXIIa. Inhibits chymotrypsin and kallikrein.
Target Involvement
Hereditary angioedema (HAE)
Target Subcellular Location
Secreted.
Target Protein Families
Serpin family
Target Synonyms
C1 esterase inhibitor; C1 Inh; C1 inhibiting factor; C1 inhibitor; C1-inhibiting factor; C1IN; C1Inh; C1NH; complement component 1 inhibitor; esterase inhibitor; HAE1; HAE2; IC1_HUMAN; Plasma protease C1 inhibitor; Serine (or cysteine) proteinase inhibitor clade G member 1; serine/cysteine proteinase inhibitor clade G member 1; Serpin G1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1; SERPING1
Target Background
This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its encoded protein, C1 inhibitor, inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. It is synthesized in the liver, and its deficiency is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform.
Notification