Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SETD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human SETD4 (NP_001007260) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SETD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human SETD4 (NP_001007260) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07102A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SETD4 |
| Target Synonyms | C21orf18; C21orf27; SETD4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human SETD4 (NP_001007260). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR | Uniprot ID | Q9NVD3 |
Uniprot Id
Q9NVD3
Target Species
Human
Target Name
SETD4
Target Full Name
SET domain-containing protein 4
Target Function
Histone-lysine N-methyltransferase that acts as a regulator of cell proliferation, cell differentiation and inflammatory response. Regulates the inflammatory response by mediating mono- and dimethylation of 'Lys-4' of histone H3 (H3K4me1 and H3K4me2, respectively), leading to activate the transcription of proinflammatory cytokines IL6 and TNF-alpha. Also involved in the regulation of stem cell quiescence by catalyzing the trimethylation of 'Lys-20' of histone H4 (H4K20me3), thereby promoting heterochromatin formation. Involved in proliferation, migration, paracrine and myogenic differentiation of bone marrow mesenchymal stem cells (BMSCs)
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily
Target Synonyms
SETD4; C21orf18; C21orf27; SET domain-containing protein 4; EC 2.1.1.-
Target Background
Enables histone methyltransferase activity (H4-K20 specific). Involved in histone H4-K20 trimethylation. Located in cytosol and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
