-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SF3B4 (NP_005841.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SF3B4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SF3B4 (NP_005841.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10508A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3B4 |
| Target Synonyms | AFD1; Hsh49; SAP49; SF3b49; SF3B4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SF3B4 (NP_005841.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP | Uniprot ID | Q15427 |
Uniprot Id
Q15427
Target Species
Human
Target Name
SF3B4
Target Full Name
Splicing factor 3B subunit 4
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
Target Involvement
Acrofacial dysostosis 1, Nager type (AFD1)
Target Subcellular Location
Nucleus.
Target Protein Families
SF3B4 family
Target Synonyms
AFD1; Hsh49; MGC10828; Pre mRNA splicing factor SF3b 49 kDa subunit; Pre-mRNA-splicing factor SF3b 49 kDa subunit; SAP 49; SAP49; Sf3b4; SF3B4_HUMAN; SF3b49; SF3b50; Spliceosomal protein; Spliceosome associated protein (U2 snRNP); Spliceosome associated protein 49; Spliceosome-associated protein 49; Splicing factor 3b subunit 4 49kDa; Splicing factor 3B subunit 4
Target Background
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.
Notification