-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SFRP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRP1 (Q8N474) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SFRP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRP1 (Q8N474) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16651A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SFRP1 |
| Target Synonyms | FRP; FRP1; FrzA; FRP-1; SARP2; SFRP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SFRP1 (Q8N474). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPL | Uniprot ID | Q8N474 |
Uniprot Id
Q8N474
Target Species
Human
Target Name
SFRP1
Target Full Name
Secreted frizzled-related protein 1
Target Function
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels. Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase. In kidney development, inhibits tubule formation and bud growth in metanephroi. Inhibits WNT1/WNT4-mediated TCF-dependent transcription.
Target Subcellular Location
Secreted. Note=Cell membrane or extracellular matrix-associated. Released by heparin-binding.
Target Protein Families
Secreted frizzled-related protein (sFRP) family
Target Tissue Specificity
Widely expressed. Absent from lung, liver and peripheral blood leukocytes. Highest levels in heart and fetal kidney. Also expressed in testis, ovary, fetal brain and lung, leiomyomal cells, myometrial cells and vascular smooth muscle cells. Expressed in f
Target Synonyms
Frizzled related protein 1; FRP 1; FRP; FRP-1; FRP1; FrzA; SARP 2; SARP-2; SARP2; Secreted apoptosis related protein 2; Secreted apoptosis-related protein 2; Secreted frizzled related protein 1; Secreted frizzled related protein; Secreted frizzled-related protein 1; SFRP 1; sFRP-1; SFRP1; SFRP1_HUMAN
Target Background
This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina.
Notification