-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHANK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SHANK3 (NP_277052.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SHANK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SHANK3 (NP_277052.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07467A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHANK3 |
| Target Synonyms | PSAP2; SCZD15; PROSAP2; SPANK-2; DEL22q13.3; SHANK3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SHANK3 (NP_277052.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQPPSRGRAGKFLDEERLLQEYPPNLDTPLPYLEFRYKRRVYAQNLIDDKQFAKLHTKANLKKFMDYVQLHSTDKVARLLDKGLDPNFHDPDSGE | Uniprot ID | Q9BYB0 |
Uniprot Id
Q9BYB0
Target Species
Human
Target Name
SHANK3
Target Full Name
SH3 and multiple ankyrin repeat domains protein 3
Target Function
Major scaffold postsynaptic density protein which interacts with multiple proteins and complexes to orchestrate the dendritic spine and synapse formation, maturation and maintenance. Interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and HOMER, respectively, and the actin-based cytoskeleton. Plays a role in the structural and functional organization of the dendritic spine and synaptic junction through the interaction with Arp2/3 and WAVE1 complex as well as the promotion of the F-actin clusters. By way of this control of actin dynamics, participates in the regulation of developing neurons growth cone motility and the NMDA receptor-signaling. Also modulates GRIA1 exocytosis and GRM5/MGLUR5 expression and signaling to control the AMPA and metabotropic glutamate receptor-mediated synaptic transmission and plasticity. May be required at an early stage of synapse formation and be inhibited by IGF1 to promote synapse maturation
Target Involvement
Phelan-McDermid syndrome (PHMDS); Schizophrenia 15 (SCZD15)
Target Subcellular Location
Cytoplasm. Cell junction, synapse, postsynaptic density. Cell projection, dendritic spine.
Target Tissue Specificity
Expressed in the cerebral cortex and the cerebellum.
Target Synonyms
AI841104; DEL22q13.3; KIAA1650; Proline rich synapse associated protein 2; Proline-rich synapse-associated protein 2; ProSAP2; PSAP2; SH3 and multiple ankyrin repeat domains 3; SH3 and multiple ankyrin repeat domains protein 3; SH3/ankyrin domain gene 3; SHAN3_HUMAN; Shank postsynaptic density protein; Shank3; Shank3b; SPANK 2; SPANK2
Target Background
This gene is a member of the Shank gene family. Shank proteins are multidomain scaffold proteins of the postsynaptic density that connect neurotransmitter receptors, ion channels, and other membrane proteins to the actin cytoskeleton and G-protein-coupled signaling pathways. Shank proteins also play a role in synapse formation and dendritic spine maturation. Mutations in this gene are a cause of autism spectrum disorder (ASD), which is characterized by impairments in social interaction and communication, and restricted behavioral patterns and interests. Mutations in this gene also cause schizophrenia type 15, and are a major causative factor in the neurological symptoms of 22q13.3 deletion syndrome, which is also known as Phelan-McDermid syndrome. Additional isoforms have been described for this gene but they have not yet been experimentally verified.
Notification