-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHARPIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human SHARPIN (NP_112236.3?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SHARPIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human SHARPIN (NP_112236.3?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02265A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHARPIN |
| Target Synonyms | SIPL1; SHARPIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, PC-3, Rat testis, Rat thymus, T-47D | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human SHARPIN (NP_112236.3?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNG | Uniprot ID | Q9H0F6 |
Uniprot Id
Q9H0F6
Target Species
Human
Target Name
SHARPIN
Target Full Name
Sharpin
Target Function
Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis.
Target Subcellular Location
Cytoplasm, cytosol. Cell junction, synapse.
Target Tissue Specificity
Highly expressed in skeletal muscle and placenta and at lower levels in brain, heart, colon without mucosa, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. Up-regulated in various tumor tissues such as kidney, liver,
Target Research Area
Cell Biology
Target Synonyms
DKFZp434N1923; hSIPL1; Shank associated RH domain interacting protein; SHANK associated RH domain interactor; Shank interacting protein like 1; Shank-associated RH domain-interacting protein; Shank-interacting protein-like 1; Sharpin; SHRPN_HUMAN; SIPL1
Target Background
Enables polyubiquitin modification-dependent protein binding activity. Involved in protein linear polyubiquitination and regulation of signal transduction. Located in cytosol. Part of LUBAC complex.
Notification