-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC13A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-240 of human SLC13A3 (NP_073740.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC13A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-240 of human SLC13A3 (NP_073740.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05225A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC13A3 |
| Target Synonyms | NaC3; NADC3; SDCT2; ARLIAK; SLC13A3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-240 of human SLC13A3 (NP_073740.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPY | Uniprot ID | Q8WWT9 |
Uniprot Id
Q8WWT9
Target Species
Human
Target Name
SLC13A3
Target Full Name
Na(+)/dicarboxylate cotransporter 3
Target Function
High-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-6 carbon atoms, including succinate, alpha-ketoglutarate and N-acetylaspartate. The stoichiometry is probably 3 Na(+) for 1 divalent succinate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC13A/DASS transporter (TC 2.A.47) family, NADC subfamily
Target Tissue Specificity
Expression is highest in kidney. Detected in placenta, brain, liver and pancreas.
Target Synonyms
dicarboxylate cotransporter 3; H sapiens mRNA for hepatocyte nuclear factor 4 gamma; hNaDC3; Na; Na(+)/dicarboxylate cotransporter 3; NaDC 3; NaDC-3; NADC3; S13A3_HUMAN; SDCT 2; SDCT2; SLC13A3; Sodium dependent high affinity dicarboxylate transporter 2; Sodium dependent high affinity dicarboxylate transporter 3; Sodium-dependent high-affinity dicarboxylate transporter 2; Solute carrier family 13 (sodium dependent dicarboxylate transporter); member 3; Solute carrier family 13 member 3
Target Background
Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.
Notification