-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC19A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-591 of human SLC19A1 (NP_919231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC19A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 452-591 of human SLC19A1 (NP_919231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03259A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC19A1 |
| Target Synonyms | RFC; CHMD; FOLT; IFC1; REFC; RFC1; hRFC; IFC-1; MEGAF; RFT-1; hSLC19A1; SLC19A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 452-591 of human SLC19A1 (NP_919231.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ | Uniprot ID | P41440 |
Uniprot Id
P41440
Target Species
Human
Target Name
SLC19A1
Target Full Name
Reduced folate transporter
Target Function
Transporter that mediates the import of reduced folates and a subset of cyclic dinucleotides. Has high affinity for N5-methyltetrahydrofolate, the predominant circulating form of folate. Also able to mediate the import of antifolate drug methotrexate. Acts as an importer of immunoreactive cyclic dinucleotides, such as cyclic GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol, and its linkage isomer 3'-3'-cGAMP. Mechanistically, acts as an antiporter, which export of intracellular organic anions to facilitate uptake of its substrates. 5-amino-4-imidazolecarboxamide riboside (AICAR), when phosphorylated to AICAR monophosphate, can serve as an organic anion for antiporter activity
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Reduced folate carrier (RFC) transporter (TC 2.A.48) family
Target Tissue Specificity
Placenta, liver, and to a much smaller extent, in lung.
Target Research Area
Others
Target Synonyms
CHMD; FLOT 1; FLOT1; Folate transporter 1; FOLT; IFC 1; IFC-1; IFC1; Intestinal folate carrier 1; Intestinal folate carrier; OTTHUMP00000115459; OTTHUMP00000115460; Placental folate transporter; Reduced folate carrier; Reduced folate carrier protein; REFC; RFC 1; RFC; RFC1; S19A1_HUMAN; SLC19A1; Solute carrier family 19 member 1
Notification