Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC35D3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC35D3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07149A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC35D3 |
| Target Synonyms | FRCL1; SLC35D3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYL | Uniprot ID | Q5M8T2 |
Uniprot Id
Q5M8T2
Target Species
Human
Target Name
SLC35D3
Target Full Name
Solute carrier family 35 member D3
Target Function
May play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
TPT transporter family, SLC35D subfamily
Target Synonyms
bA55K22.3; Frc fringe like 1; FRCL1; Fringe connection like protein 1; Fringe connection-like protein 1; MGC102873; S35D3_HUMAN; SLC35D3; Solute carrier family 35 member D3
Target Background
Predicted to enable antiporter activity and pyrimidine nucleotide-sugar transmembrane transporter activity. Predicted to be involved in carbohydrate transport and pyrimidine nucleotide-sugar transmembrane transport. Predicted to act upstream of or within energy homeostasis and positive regulation of protein exit from endoplasmic reticulum. Predicted to be located in early endosome and endoplasmic reticulum. Predicted to be integral component of membrane. Predicted to be active in Golgi apparatus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
