-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC46A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC46A1 (NP_001229295.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC46A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC46A1 (NP_001229295.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02530A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC46A1 |
| Target Synonyms | G21; HCP1; PCFT; hPCFT; HsPCFT; SLC46A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60(Negative control), Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC46A1 (NP_001229295.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALV | Uniprot ID | Q96NT5 |
Uniprot Id
Q96NT5
Target Species
Human
Target Name
SLC46A1
Target Full Name
Proton-coupled folate transporter
Target Function
Proton-coupled high-affinity folate and heme transporter that plays an essential role in iron metabolism. Acts as the main importer of heme in the intestine. Imports also heme in the retina and retinal pigment epithelium, in neurons of the hippocampus, and in the renal epithelial cells. Participates therefore in the trafficking of heme and increases intracellular iron content. Mediates also intestinal absorption of folates and their transport from blood to cerebrospinal fluid across the choroid plexus.
Target Involvement
Hereditary folate malabsorption (HFM)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cytoplasm.
Target Protein Families
Major facilitator superfamily, SLC46A family
Target Tissue Specificity
Expressed in kidney, liver, placenta, small intestine, spleen, retina and retinal pigment epithelium. Lower levels found in colon and testis. Very low levels in brain, lung, stomach, heart and muscle. In intestine, expressed in duodenum with lower levels
Target Synonyms
G21; HCP 1; HCP1; Heme carrier protein 1; MGC9564; PCFT; PCFT/HCP1; PCFT_HUMAN; PDE7A; Proton coupled folate transporter; Proton-coupled folate transporter; SLC46A1; Solute carrier family 46 (folate transporter) member 1; Solute carrier family 46 member 1
Target Background
This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes, optimally in acidic pH environments. This protein is also expressed in the brain and choroid plexus where it transports folates into the central nervous system. This protein further functions as a heme transporter in duodenal enterocytes, and potentially in other tissues like liver and kidney. Its localization to the apical membrane or cytoplasm of intestinal cells is modulated by dietary iron levels. Mutations in this gene are associated with autosomal recessive hereditary folate malabsorption disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification