-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_001167560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC4A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_001167560.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04751A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A11 |
| Target Synonyms | BTR1; CHED; CDPD1; CHED2; NABC1; dJ794I6.2; SLC4A11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_001167560.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAATRRVFHLQPCENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHLLSD | Uniprot ID | Q8NBS3 |
Uniprot Id
Q8NBS3
Target Species
Human
Target Name
SLC4A11
Target Full Name
Solute carrier family 4 member 11
Target Function
Multifunctional transporter with an impact in cell morphology and differentiation. In the presence of borate B(OH)4(-), acts as a voltage-dependent electrogenic Na(+)-coupled B(OH)4(-) cotransporter controlling boron homeostasis. At early stages of stem cell differentiation, participates in synergy with ITGA5-ITGB1 and ITGAV-ITGB3 integrins and BMPR1A to promote cell adhesion and contractility that drives differentiation toward osteogenic commitment while inhibiting adipogenesis. In the absence of B(OH)4(-), acts as a Na(+)-coupled OH(-) or H(+) permeable channel with implications in cellular redox balance. Regulates the oxidative stress response in corneal endothelium by enhancing antioxidant defenses and protecting cells from reactive oxygen species. In response to hypo-osmotic challenge, also acts as water permeable channel at the basolateral cell membrane of corneal endothelial cells and facilitates transendothelial fluid reabsorption in the aqueous humor. In the presence of ammonia, acts as an electrogenic NH3/H(+) cotransporter and may play a role in ammonia transport and reabsorption in renal Henle's loop epithelium.
Target Involvement
Corneal dystrophy and perceptive deafness (CDPD); Corneal endothelial dystrophy (CHED); Corneal dystrophy, Fuchs endothelial, 4 (FECD4)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Tissue Specificity
Widely expressed. Highly expressed in kidney, testis, salivary gland, thyroid, trachea and corneal endothelium. Not detected in retina and lymphocytes.; [Isoform 3]: Expressed in corneal endothelium (at protein level).; [Isoform 5]: The predominant isofor
Target Synonyms
Bicarbonate transporter related protein 1; Bicarbonate transporter-related protein 1; BTR1; CDPD; CHED2; Corneal endothelial dystrophy 2 autosomal recessive; dJ794I6.2; FECD4; MGC126418; MGC126419; NaBC1; S4A11_HUMAN; Slc4a11; Sodium bicarbonate transporter-like protein 11; Sodium borate cotransporter 1; Sodium coupled borate cotransporter 1; Solute carrier family 4 member 11; Solute carrier family 4 sodium bicarbonate transporter like member 11; Solute carrier family 4 sodium borate transporter member 11
Target Background
This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described.
Notification