Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-640 of human SLC5A11 (NP_443176.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC5A11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-640 of human SLC5A11 (NP_443176.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03476A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A11 |
| Target Synonyms | KST1; RKST1; SGLT6; SMIT2; SLC5A11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-640 of human SLC5A11 (NP_443176.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAE | Uniprot ID | Q8WWX8 |
Uniprot Id
Q8WWX8
Target Species
Human
Target Name
SLC5A11
Target Full Name
Sodium/myo-inositol cotransporter 2
Target Function
Involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na(+):MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Tissue Specificity
Highest expression in heart, skeletal muscle, kidney, liver and placenta. Weaker expression in brain, colon, spleen, lung and peripheral blood leukocytes.
Target Synonyms
homolog of rabbit KST1; KST1; Na(+)/myo-inositol cotransporter 2; na+/myo-inositol cotransporter 2; putative sodium-coupled cotransporter RKST1; RKST1; SC5AB_HUMAN; SGLT6; SLC5A11; SMIT2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; Sodium/myo-inositol cotransporter 2; Sodium/myo-inositol transporter 2; solute carrier family 5 (sodium/glucose cotransporter); member 11; Solute carrier family 5 member 11
Target Background
Cotransporters, such as SLC5A11, represent a major class of proteins that make use of ion gradients to drive active transport for the cellular accumulation of nutrients, neurotransmitters, osmolytes, and ions Roll et al. (2002) [PubMed 12039040].
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
