-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A5 |
| Target Synonyms | NET1; GLYT2; HKPX3; GLYT-2; SLC6A5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, SH-SY5Y, U-251MG, U-87MG, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF | Uniprot ID | Q9Y345 |
Uniprot Id
Q9Y345
Target Species
Human
Target Name
SLC6A5
Target Full Name
Sodium- and chloride-dependent glycine transporter 2
Target Function
Sodium- and chloride-dependent glycine transporter. Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May be responsible for the termination of neurotransmission at strychnine-sensitive glycinergic synapses.
Target Involvement
Hyperekplexia 3 (HKPX3)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A5 subfamily
Target Tissue Specificity
Expressed in medulla, and to a lesser extent in spinal cord and cerebellum.
Target Synonyms
Glycine transporter; Glycine transporter type 2; GlyT-2; GlyT2; NET1; SC6A5_HUMAN; SC6AC5; Slc6a5; SLC6A5 solute carrier family 6 neurotransmitter transporter, glycine member 5; Slc6a9; Sodium and chloride dependent glycine transporter 2; Sodium- and chloride-dependent glycine transporter 2; Solute carrier family 6 member 5; Solute carrier family 6 neurotransmitter transporter glycine member 5
Target Background
This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.
Notification