-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMMHC/MYH11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMMHC/MYH11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14943A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMMHC/MYH11 |
| Target Synonyms | AAT4; FAA4; SMHC; SMMHC; VSCM2; SMMS-1; SMMHC/MYH11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, Mouse bone(Low expression control), Mouse lung, Mouse uterus, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL | Uniprot ID | P35749 |
Uniprot Id
P35749
Target Species
Human
Target Name
MYH11
Target Full Name
Myosin-11
Target Function
Muscle contraction.
Target Involvement
Aortic aneurysm, familial thoracic 4 (AAT4)
Target Subcellular Location
Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Thick filaments of the myofibrils.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
Smooth muscle; expressed in the umbilical artery, bladder, esophagus and trachea. Isoform 1 is mostly found in slowly contracting tonic muscles.
Target Synonyms
AAT4; DKFZp686D10126; DKFZp686D19237; FAA4; FLJ35232; MGC126726; MGC32963; MYH 11; MYH11; MYH11_HUMAN; Myosin 11; Myosin heavy chain 11; Myosin heavy chain 11 smooth muscle; Myosin heavy chain; Myosin heavy chain smooth muscle isoform; Myosin heavy polypeptide 11 smooth muscle; Myosin-11; SMHC; SMMHC; smooth muscle isoform; Smooth muscle myosin heavy chain 11 isoform SM2; Smooth muscle myosin heavy chain isoform SM2
Target Background
The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.
Notification