Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMPD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMPD2 (NP_003071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMPD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMPD2 (NP_003071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMPD2 |
| Target Synonyms | ISC1; NSMASE; NSMASE1; SMPD2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMPD2 (NP_003071.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYI | Uniprot ID | O60906 |
Uniprot Id
O60906
Target Species
Human
Target Name
SMPD2
Target Full Name
Sphingomyelin phosphodiesterase 2
Target Function
Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor).
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Neutral sphingomyelinase family
Target Synonyms
SMPD2; Sphingomyelin phosphodiesterase 2; Lyso-platelet-activating factor-phospholipase C; Lyso-PAF-PLC; Neutral sphingomyelinase; N-SMase; nSMase; nSMase1
Target Background
This gene encodes a protein which was initially identified as a sphingomyelinase based on sequence similarity between bacterial sphingomyelinases and a yeast protein. Subsequent studies showed that its biological function is less likely to be as a sphingomyelinase and instead as a lysophospholipase.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
