-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 321-400 of human SNX4 (NP_003785.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against SNX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 321-400 of human SNX4 (NP_003785.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14519A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNX4 |
| Target Synonyms | ATG24B; SNX4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, Jurkat | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 321-400 of human SNX4 (NP_003785.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFV | Uniprot ID | O95219 |
Uniprot Id
O95219
Target Species
Human
Target Name
SNX4
Target Full Name
Sorting nexin-4
Target Function
Involved in the regulation of endocytosis and in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation. Involved in autophagosome assembly by regulating trafficking and recycling of phospholipid scramblase ATG9A.
Target Subcellular Location
Early endosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Sorting nexin family
Target Synonyms
ATG24B; SNX 4; snx4; SNX4_HUMAN; Sorting nexin 4; Sorting nexin-4
Target Background
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene.
Notification