-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 525-600 of human SOX13 (NP_005677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOX13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 525-600 of human SOX13 (NP_005677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08258A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX13 |
| Target Synonyms | SOX13; ICA12; Sox-13; SRY-box 13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NTERA-2, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 525-600 of human SOX13 (NP_005677.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR | Uniprot ID | Q9UN79 |
Uniprot Id
Q9UN79
Target Species
Human
Target Name
SOX13
Target Full Name
Transcription factor SOX-13
Target Function
Transcription factor that binds to DNA at the consensus sequence 5'-AACAAT-3'. Binds to the proximal promoter region of the myelin protein MPZ gene, and may thereby be involved in the differentiation of oligodendroglia in the developing spinal tube. Binds to the gene promoter of MBP and acts as a transcriptional repressor. Binds to and modifies the activity of TCF7/TCF1, thereby inhibiting transcription and modulates normal gamma-delta T-cell development and differentiation of IL17A expressing gamma-delta T-cells. Regulates expression of BLK in the differentiation of IL17A expressing gamma-delta T-cells. Promotes brown adipocyte differentiation. Inhibitor of WNT signaling.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in exocrine cells and islets of Langerhans in the pancreas (at protein level). Expressed in the pancreas, placenta, kidney, brain, heart, lung, and liver. Expressed in adipose tissue, cervix, colon, esophagus, ovary, prostate, small intestine, s
Target Synonyms
ICA 12; ICA12; Islet cell 12; Islet cell antigen 12; MGC117216; SOX 13; SOX 13 protein; sox13; SOX13 protein; SOX13_HUMAN; SRY (Sex determining region Y)-box 13; SRY box 13; SRY box containing gene 13; SRY related HMG box gene 13; SRY sex determining region Y box 13; Transcription factor SOX 13; Transcription factor Sox-13; Type 1 diabetes autoantigen; Type 1 diabetes autoantigen ICA 12; Type 1 diabetes autoantigen ICA12
Target Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.
Notification