Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 91-240 of human SOX14 (NP_004180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SOX14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 91-240 of human SOX14 (NP_004180.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06122A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX14 |
| Target Synonyms | SOX28; SOX14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 91-240 of human SOX14 (NP_004180.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM | Uniprot ID | O95416 |
Uniprot Id
O95416
Target Species
Human
Target Name
SOX14
Target Full Name
Transcription factor SOX-14
Target Function
Acts as a negative regulator of transcription.
Target Subcellular Location
Nucleus.
Target Synonyms
SOX14; SOX28; Transcription factor SOX-14; Protein SOX-28
Target Background
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
