-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPDEF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SPDEF ( NP_036523.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPDEF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SPDEF ( NP_036523.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08481A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPDEF |
| Target Synonyms | PDEF; bA375E1.3; SPDEF | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, T-47D | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SPDEF ( NP_036523.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQA | Uniprot ID | O95238 |
Uniprot Id
O95238
Target Species
Human
Target Name
SPDEF
Target Full Name
SAM pointed domain-containing Ets transcription factor
Target Function
May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Expressed in a very restricted set of primarily hormone-regulated epithelial tissues with particularly high expression in the prostate gland. Significantly lower expression is seen in other hormone regulated tissues such as mammary gland, salivary gland,
Target Synonyms
bA375E1.3; PDEF; Prostate derived Ets factor; PROSTATE EPITHELIUM SPECIFIC ETS TRANSCRIPTION FACTOR; Prostate epithelium-specific Ets transcription factor; Prostate specific Ets; Prostate-derived Ets factor; Prostate-specific Ets; PSE; RP11-375E1__A.3; SAM POINTED DOMAIN CONTAINING ETS TRANSCRIPTION FACTOR; SAM pointed domain-containing Ets transcription factor; Spdef; SPDEF_HUMAN
Target Background
The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification