Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPSB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPSB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05964A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPSB1 |
| Target Synonyms | SSB1; SSB-1; SPSB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, A375, Mouse spleen, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND | Uniprot ID | Q96BD6 |
Uniprot Id
Q96BD6
Target Species
Human
Target Name
SPSB1
Target Full Name
SPRY domain-containing SOCS box protein 1
Target Function
Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2. Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol.
Target Protein Families
SPSB family
Target Research Area
Others
Target Synonyms
1110014L01Rik; 4930422J18Rik; AI596360; AI854583; MGC102221; novel SPRY domain containing protein; OTTHUMP00000001398; OTTMUSP00000010942; OTTMUSP00000010943; OTTMUSP00000023475; RGD1309319; RP23-169H13.1; RP3-324M8.1; splA/ryanodine receptor domain and SOCS box containing 1; SPRY domain containing SOCS box protein SSB 1; SPRY domain-containing SOCS box protein 1; SPSB1; SPSB1_HUMAN; SSB 1; SSB-1; SSB1
Target Background
Enables ubiquitin ligase-substrate adaptor activity. Involved in protein ubiquitination and ubiquitin-dependent protein catabolic process. Located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
