Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRD5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRD5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse skin, using SRD5A1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-11408A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRD5A1 |
| Target Synonyms | S5AR 1; SRD5A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skin | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF | Uniprot ID | P18405 |
Uniprot Id
P18405
Target Species
Human
Target Name
SRD5A1
Target Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
Target Function
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Target Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Steroid 5-alpha reductase family
Target Tissue Specificity
Liver and prostate (at a low level).
Target Research Area
Neuroscience
Target Synonyms
SRD5A1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; Steroid 5-alpha-reductase 1; S5AR 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
