-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRGN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-158 of human SRGN (NP_002718.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SRGN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-158 of human SRGN (NP_002718.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03591A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRGN |
| Target Synonyms | PPG; PRG; PRG1; SRGN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-158 of human SRGN (NP_002718.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML | Uniprot ID | P10124 |
Uniprot Id
P10124
Target Species
Human
Target Name
SRGN
Target Full Name
Serglycin
Target Function
Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.
Target Subcellular Location
Cytoplasmic granule. Cytolytic granule. Secreted, extracellular space. Golgi apparatus.
Target Protein Families
Serglycin family
Target Synonyms
Chondroitin sulfate proteoglycan core protein; Cytolytic granule proteoglycan core protein; FLJ12930; gp600; Hematopoetic proteoglycan core protein; Mastocytoma proteoglycan core protein; MGC9289; OTTHUMP00000019716; P.PG; PG19 core protein; Pgsg; Platelet proteoglycan core protein; platelet proteoglycan protein core; PLATELET PROTEOGLYCAN PROTEIN CORE; PPG; PPG; PRG; PRG1; PROTEOGLYCAN 1; proteoglycan 1; secretory granule; Proteoglycan 10K core protein; Proteoglycan peptide core protein; PROTEOGLYCAN PROTEIN CORE FOR MAST CELL SECRETORY GRANULE; secretory granule proteoglycan 1; Secretory granule proteoglycan core peptide; Secretory granule proteoglycan core protein; Serglycin; serglycin proteoglycan; Sgc; Srgn; SRGN_HUMAN
Target Background
This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.
Notification