Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SRRM1 (NP_005830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SRRM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SRRM1 (NP_005830.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03601A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRRM1 |
| Target Synonyms | 160-KD; POP101; SRM160; SRRM1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HT-29, Jurkat, LO2, Mouse liver, OVCAR3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SRRM1 (NP_005830.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKE | Uniprot ID | Q8IYB3 |
Uniprot Id
Q8IYB3
Target Species
Human
Target Name
SRRM1
Target Full Name
Serine/arginine repetitive matrix protein 1
Target Function
Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates.
Target Subcellular Location
Nucleus matrix. Nucleus speckle.
Target Protein Families
Splicing factor SR family
Target Synonyms
160-KD; POP101; SRM160; SRRM1
Target Background
Enables RNA binding activity. Predicted to be involved in mRNA splicing, via spliceosome. Located in nuclear speck. Part of catalytic step 2 spliceosome. Biomarker of gestational diabetes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
