-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SRSF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SRSF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09106A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SRSF7 |
| Target Synonyms | 9G8; AAG3; SFRS7; SRSF7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH | Uniprot ID | Q16629 |
Uniprot Id
Q16629
Target Species
Human
Target Name
SRSF7
Target Full Name
Serine/arginine-rich splicing factor 7
Target Function
Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Splicing factor SR family
Target Tissue Specificity
Brain, liver, kidney and lung.
Target Synonyms
9G8; AAG3; arginine/serine-rich 7; HSSG1; RBM37; Serine/arginine-rich splicing factor 7; Splicing factor 9G8; Splicing factor; Splicing factor, arginine/serine rich 7; SRSF7; SRSF7_HUMAN; ZCCHC20; ZCRB2
Target Background
The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an N-terminal RNA recognition motif (RRM) for binding RNA and a C-terminal RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification