Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against STAT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-16597A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAT4 |
| Target Synonyms | SLEB11; STAT4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, PC-3 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE | Uniprot ID | Q14765 |
Uniprot Id
Q14765
Target Species
Human
Target Name
STAT4
Target Full Name
Signal transducer and activator of transcription 4
Target Function
Carries out a dual signal transduction and activation of transcription. Involved in IL12 signaling.
Target Involvement
Systemic lupus erythematosus 11 (SLEB11); Rheumatoid arthritis (RA)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
Target Protein Families
Transcription factor STAT family
Target Synonyms
Signal transducer and activator of transcription 4; SLEB11; STAT4; STAT4_HUMAN
Target Background
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
