-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAT5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 635-794 of human STAT5A (NP_003143.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STAT5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 635-794 of human STAT5A (NP_003143.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12507A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAT5A |
| Target Synonyms | MGF; STAT5; STAT5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 635-794 of human STAT5A (NP_003143.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS | Uniprot ID | P42229 |
Uniprot Id
P42229
Target Species
Human
Target Name
STAT5A
Target Full Name
Signal transducer and activator of transcription 5A
Target Function
Carries out a dual signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocated into the nucleus in response to phosphorylation.
Target Protein Families
Transcription factor STAT family
Target Synonyms
MGF; Signal transducer and activator of transcription 5A; Signal Transducer and Activator of Transcription 5B; STA5A_HUMAN; STAT 5A; STAT 5B; STAT5; STAT5A; STAT5B; Transcription factor STAT5A; Transcription factor STAT5B
Target Background
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. Alternatively spliced transcript variants have been found for this gene.
Notification