Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STRN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 581-780 of human STRN (NP_003153.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against STRN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 581-780 of human STRN (NP_003153.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09287A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STRN |
| Target Synonyms | SG2NA; STRN1; PPP2R6A; STRN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, A-549, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 581-780 of human STRN (NP_003153.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV | Uniprot ID | O43815 |
Uniprot Id
O43815
Target Species
Human
Target Name
STRN
Target Full Name
Striatin
Target Function
Calmodulin-binding protein which may function as scaffolding or signaling protein and may play a role in dendritic Ca(2+) signaling.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Cell projection, dendritic spine.
Target Protein Families
WD repeat striatin family
Target Tissue Specificity
Preferentially expressed in brain.
Target Synonyms
MGC125642; SG2NA; Striatin; Striatin Calmodulin binding protein ; STRN; STRN_HUMAN
Target Background
Enables armadillo repeat domain binding activity; estrogen receptor binding activity; and protein phosphatase 2A binding activity. Involved in Wnt signaling pathway and negative regulation of cell population proliferation. Located in bicellular tight junction. Part of FAR/SIN/STRIPAK complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
