Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULT1A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SULT1A3 (NP_808220.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SULT1A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SULT1A3 (NP_808220.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02322A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULT1A3 |
| Target Synonyms | STM; HAST; HAST3; M-PST; ST1A3; ST1A4; ST1A5; TL-PST; ST1A3/ST1A4; SULT1A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, HT-29, LO2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SULT1A3 (NP_808220.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTP | Uniprot ID | P0DMM9 |
Uniprot Id
P0DMM9
Target Species
Human
Target Name
SULT1A3
Target Full Name
Sulfotransferase 1A3
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.
Target Research Area
Neuroscience
Target Synonyms
SULT1A3; STM; Sulfotransferase 1A3; ST1A3; EC 2.8.2.1; Aryl sulfotransferase 1A3/1A4; Catecholamine-sulfating phenol sulfotransferase; HAST3; M-PST; Monoamine-sulfating phenol sulfotransferase; Placental estrogen sulfotransferase; Sulfotransferase 1A3/1A4; Sulfotransferase; monoamine-preferring; Thermolabile phenol sulfotransferase; TL-PST
Target Background
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containing GIY-YIG domains.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
