-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULT1C2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SULT1C2 (NP_001047.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SULT1C2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SULT1C2 (NP_001047.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01764A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULT1C2 |
| Target Synonyms | ST1C1; ST1C2; SULT1C1; humSULTC2; SULT1C2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SULT1C2 (NP_001047.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFW | Uniprot ID | O00338 |
Uniprot Id
O00338
Target Species
Human
Target Name
SULT1C2
Target Full Name
Sulfotransferase 1C2
Target Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation. Sulfonates p-nitrophenol, a small phenolic compond. Does not sulfonate steroids, dopamine, acetaminophen, or alpha-naphthol. Catalyzes the sulfonation of the carcinogenic N-Hydroxy-2-acetylaminofluorene leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.
Target Subcellular Location
Cytoplasm. Lysosome.
Target Protein Families
Sulfotransferase 1 family
Target Tissue Specificity
Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
Target Synonyms
humSULTC2; ST1C1 ; ST1C2; ST1C2_HUMAN; Sulfotransferase 1C1; Sulfotransferase 1C2; Sulfotransferase family cytosolic 1C member 1; Sulfotransferase family cytosolic 1C member 2; SULT1C#1; SULT1C1 ; SULT1C2
Target Background
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification