-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TBX5 (NP_852259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TBX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TBX5 (NP_852259.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10078A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBX5 |
| Target Synonyms | HOS; TBX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TBX5 (NP_852259.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV | Uniprot ID | Q99593 |
Uniprot Id
Q99593
Target Species
Human
Target Name
TBX5
Target Full Name
T-box transcription factor TBX5
Target Function
DNA-binding protein that regulates the transcription of several genes and is involved in heart development and limb pattern formation. Binds to the core DNA motif of NPPA promoter.
Target Involvement
Holt-Oram syndrome (HOS)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Research Area
Cardiovascular
Target Synonyms
Holt Oram syndrome; HOS; T box 5; T box protein 5; T box transcription factor TBX 5; T box transcription factor TBX5; T-box protein 5; T-box transcription factor TBX5; TBX 5; TBX5; TBX5_HUMAN; Transcription factor T box 5
Target Background
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
Notification