-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFAP2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human TFAP2C (NP_003213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFAP2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human TFAP2C (NP_003213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02358A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFAP2C |
| Target Synonyms | ERF1; TFAP2G; hAP-2g; AP2-GAMMA; TFAP2C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SK-BR-3, T-47D | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TFAP2C (NP_003213.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK | Uniprot ID | Q92754 |
Uniprot Id
Q92754
Target Species
Human
Target Name
TFAP2C
Target Full Name
Transcription factor AP-2 gamma
Target Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.
Target Subcellular Location
Nucleus.
Target Protein Families
AP-2 family
Target Synonyms
Activating enhancer binding protein 2 gamma; Activating enhancer-binding protein 2 gamma; AP2-gamma; AP2C_HUMAN; AP2g; AP2gamma; ERF 1; ERF1; Estrogen receptor factor 1; hAP 2g; hAP2g; TFAP 2C; TFAP 2G; Tfap2c; TFAP2G; Transcription factor AP 2 gamma (activating enhancer binding protein 2 gamma); Transcription factor AP 2 gamma; Transcription factor AP-2 gamma; Transcription factor ERF 1; Transcription factor ERF-1; Transcription factor ERF1
Target Background
The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.
Notification